PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11080.1.p
Common NameBRADI_2g11080, LOC100846398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 430aa    MW: 47827.6 Da    PI: 6.6207
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l++ ++++G g+W+t+++  g+ R++k+c++rw +yl
  Bradi2g11080.1.p 14 KGLWSPEEDEKLLNHINKHGHGCWSTVPKLAGLQRCGKSCRLRWMNYL 61
                      678*******************************************97 PP

2Myb_DNA-binding40.28.1e-1367110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++ +eE++l++++++ lG++ W+ Ia ++  gRt++++k+ w++
  Bradi2g11080.1.p  67 RGAFEQEEEDLIIELHAVLGNK-WSQIATRLA-GRTDNEIKNLWNS 110
                       899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.672965IPR017930Myb domain
SuperFamilySSF466899.56E-2912108IPR009057Homeodomain-like
SMARTSM007176.8E-141363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001673.10E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.52666116IPR017930Myb domain
SMARTSM007171.8E-1066114IPR001005SANT/Myb domain
PfamPF002491.5E-1167110IPR001005SANT/Myb domain
CDDcd001672.41E-772109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIN KHGHGCWSTV PKLAGLQRCG KSCRLRWMNY  60
LRPDLKRGAF EQEEEDLIIE LHAVLGNKWS QIATRLAGRT DNEIKNLWNS CIKKKLRQKG  120
LDPNTHKPLA DEADRRKVAP TMSTERTSES SDVDQSSAGA LGNLSHLLTE TAQSPELLPV  180
LGKQRAKTPS LTCVKVPPKE FFLDQLASGH ESLPSCHSSL PMPNFPFQQP PCYSNGFSSR  240
DGGSKNSLWW FNQNESSGSA ISTVMPPVSP STLSTSTVLN LSPDNPHSGG TGIHSAQFYW  300
DTANPSSSCS TRSSGNNNLG FELQSTSSLL ENSVFPWAEL AQDKDSQVHL EEELKWPELL  360
HGTFPETSTA MQNLSQSLYE DVVKAESQFN MEGLCAAWSQ NLQPQQHLQL VTDMYDKDLQ  420
RMSSPFENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM7479400.0HM747940.1 Phyllostachys edulis MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567480.10.0PREDICTED: transcription factor MYB86
TrEMBLI1HEN80.0I1HEN8_BRADI; Uncharacterized protein
STRINGBRADI2G11080.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-84myb domain protein 61